- Recombinant Danio rerio Transmembrane protein 205 (tmem205)
- MyBioSource.com
- Pricing InfoSupplier PageView Company Product Page
- MBS1171991
- 1 mg (E Coli Derived)
- This item requires custom production and lead time is between 5-9 weeks. We can custom produce according to your specifications
- >90%
- Recombinant Protein
- 21,301 Da
- E Coli or Yeast
- 1-188
- transmembrane protein 205
- zgc:158860
- Transmembrane protein 205 (tmem205)
Sequence
MATEGDPTDFVKVLHLLVISFTWGMQVWVSFIAGFVLISQVSMHTFGLVQSKLFPVYFYCLLGGNAVSLAVYAVYHPRELLDWHEGIQMSLFFVAVIMAGLNAQWFGPSATENMLVMQEIEKEHGLGNQVGMSSNREGYTKLREQDPKYKEHRSTFYRYHGLSNLCNLIGFFCITVNLIYLALNLGTI